Isoelectric Point Calculator

Calculate the isoelectric point (pI) of proteins from their amino acid sequence

Input Sequence

Ionizable Residues

Positive (basic)

Histidine (H)3
Lysine (K)4
Arginine (R)1
Total Basic8

Negative (acidic)

Aspartic acid (D)2
Glutamic acid (E)3
Cysteine (C)0
Tyrosine (Y)2
Total Acidic7

Isoelectric Point (pI)

7.90

Charge at Common pH Values

Charge at pH 7.0+0.27
Charge at pH 7.4 (physiological)+0.11
Sequence Length51 aa

Charge vs pH

pH 0pH 7pH 14

About Isoelectric Point

The isoelectric point (pI) is the pH at which a protein carries no net electrical charge. At this pH:

  • The protein is least soluble
  • The protein will not migrate in an electric field
  • Positive and negative charges are balanced

This calculator uses the Henderson-Hasselbalch equation with pKa values for ionizable amino acid side chains.

What Is the Isoelectric Point (pI)?

The isoelectric point, abbreviated pI (sometimes written pH(I) or IEP), is the pH at which a protein or peptide carries no net electrical charge. At this specific pH the number of protonated positive groups exactly balances the number of deprotonated negative groups, so the molecule is electrically neutral overall even though individual side chains remain charged. The isoelectric point calculator on this page computes that pH directly from an amino acid sequence, so you can predict protein behavior before you ever step into the lab.

Why does the pI matter so much? At its isoelectric point a protein reaches its minimum solubility, because there is no net charge to drive electrostatic repulsion between molecules, and proteins tend to aggregate and precipitate. In an electric field a molecule at its pI will not migrate, which is the entire physical basis of isoelectric focusing and two-dimensional gel electrophoresis. When the surrounding pH is below the pI the protein carries a net positive charge, and when the pH is above the pI it carries a net negative charge. This single number therefore tells you the sign of the charge at any working pH, which is essential for choosing buffers, ion-exchange resins, and purification strategies.

Proteins rich in acidic residues such as aspartate and glutamate have low pI values, while proteins rich in basic residues such as lysine and arginine have high pI values. Most cytoplasmic proteins cluster in the slightly acidic-to-neutral range, which is why so many sit just below physiological pH. The protein pI calculator makes these trends concrete by reporting the exact net charge at pH 7.0 and at physiological pH 7.4 alongside the pI itself.

How This Isoelectric Point Calculator Works

This calculator works entirely from the primary amino acid sequence you paste into the input box. First it cleans the text, converting it to uppercase and stripping out any character that is not one of the twenty standard one-letter amino acid codes (A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, V). It then counts the seven ionizable side chains that influence charge: aspartate (D), glutamate (E), cysteine (C), and tyrosine (Y) on the acidic side, and histidine (H), lysine (K), and arginine (R) on the basic side. The free N-terminus and C-terminus of the chain are always included as one additional positive and one additional negative group.

For every ionizable group the calculator applies the Henderson-Hasselbalch equation to find the fraction of molecules that carry charge at a given pH. Positive groups contribute a charge of +1 / (1 + 10^(pH - pKa)) each, while negative groups contribute -1 / (1 + 10^(pKa - pH)) each. Summing all of these contributions gives the net charge of the protein at that pH.

To find the pI, the tool runs a binary search across the pH range from 0 to 14. It evaluates the net charge at the midpoint, and if the charge is still positive it moves the lower bound up, otherwise it moves the upper bound down. It repeats this bisection until the interval narrows to within 0.001 pH units, which pinpoints the pH where net charge crosses zero. The same charge function is then sampled across the full pH range to draw the charge-versus-pH curve and to report the net charge at pH 7.0 and pH 7.4.

Net Charge and Isoelectric Point

Q(pH) = sum[ n_pos / (1 + 10^(pH - pKa_pos)) ] - sum[ n_neg / (1 + 10^(pKa_neg - pH)) ]; pI = pH where Q(pH) = 0

Where:

  • Q(pH)= net charge of the protein at a given pH
  • n_pos= count of each positive group (N-terminus, His, Lys, Arg)
  • n_neg= count of each negative group (C-terminus, Asp, Glu, Cys, Tyr)
  • pKa_pos= pKa of a basic group (N-term 9.69, H 6.00, K 10.53, R 12.48)
  • pKa_neg= pKa of an acidic group (C-term 2.34, D 3.86, E 4.25, C 8.33, Y 10.07)
  • pI= the pH at which net charge Q equals zero

pKa Values Used by the Calculator

The accuracy of any isoelectric point calculator depends on the set of pKa values it uses for the ionizable groups. Different reference tables differ by a few tenths of a pH unit, which is why pI predictions from different tools can disagree slightly. This calculator uses a single fixed, well-established set of values, shown below, applied identically to every residue of that type.

Group One-letter code pKa Charge sign
N-terminus9.69Positive
C-terminus2.34Negative
Aspartic acidD3.86Negative
Glutamic acidE4.25Negative
CysteineC8.33Negative
TyrosineY10.07Negative
HistidineH6.00Positive
LysineK10.53Positive
ArginineR12.48Positive

Notice that cysteine and tyrosine are treated as weakly acidic groups: their thiol and phenol hydroxyl protons ionize at relatively high pH, so they only begin to carry negative charge in alkaline conditions. Histidine, with a pKa near 6.0, is the only side chain whose charge changes meaningfully right around physiological pH, which is why histidine residues are so often found in enzyme active sites that switch between protonated and deprotonated states.

Interpreting Your pI and Net Charge Results

The calculator reports three headline numbers: the isoelectric point (pI), the net charge at pH 7.0, and the net charge at the physiological pH of 7.4. Reading them together gives a complete charge profile. If your protein's pI is below 7, the molecule already carries a net negative charge at neutral pH, and the net-charge readouts will confirm this with negative values. If the pI is above 7, the protein is net positive at neutral pH.

The relationship is simple and reliable: at any pH below the pI the protein is positively charged, at any pH above the pI it is negatively charged, and exactly at the pI the net charge is zero. The charge-versus-pH curve plotted on the page visualizes this crossover, with blue points marking positive net charge and red points marking negative net charge. The point where the curve crosses the horizontal axis is the pI.

For practical work, the magnitude of the charge matters as much as the sign. A protein with a net charge of several units at your working pH will bind strongly to an oppositely charged ion-exchange resin and is unlikely to aggregate, whereas a protein whose net charge is close to zero is near its pI and may precipitate. Because the calculator counts only side chains and termini and applies fixed pKa values, the predicted pI is a sequence-based estimate; the experimentally measured pI can shift due to the three-dimensional fold, buried residues, post-translational modifications, and local electrostatic environments. Treat the result as a strong starting hypothesis for buffer and purification design rather than an exact measured constant.

Where Isoelectric Point Calculations Are Used

Knowing a protein's isoelectric point is a daily necessity across biochemistry, molecular biology, and bioprocessing. In protein purification, the pI tells you whether to use a cation or anion exchange column at a given buffer pH: load below the pI and the protein binds a cation exchanger, load above the pI and it binds an anion exchanger. Choosing a buffer pH one to two units away from the pI keeps the protein soluble and well charged for binding and elution.

In isoelectric focusing (IEF) and two-dimensional gel electrophoresis, proteins migrate through a pH gradient until they reach the position where the local pH equals their pI and they stop moving. Predicting pI values in advance helps you select the correct pH range for immobilized pH gradient strips and interpret which spot corresponds to which protein. The pI also predicts where a protein sits in an SDS-PAGE or native gel relative to others.

Beyond electrophoresis, pI values guide crystallization screens (proteins often crystallize best near their pI where solubility is lowest), antibody and biologic formulation (where charge governs viscosity and stability), and the design of fusion tags and charge-engineering mutations. Researchers studying enzymes use pI and per-residue charge to reason about catalytic mechanisms, while structural biologists use net charge to predict electrostatic surface potentials. Whenever you need to predict how a protein behaves in a buffer, an electric field, or a chromatography column, the isoelectric point is one of the first numbers worth calculating.

Worked Examples

Acidic peptide with two aspartates and one glutamate

Problem:

Estimate the pI and the net charge at pH 7.0 for a short peptide containing 2 aspartate (D) and 1 glutamate (E) residues and no basic side chains.

Solution Steps:

  1. 1Identify ionizable groups: N-terminus (+, pKa 9.69), C-terminus (-, pKa 2.34), 2 x Asp (-, pKa 3.86), 1 x Glu (-, pKa 4.25).
  2. 2Compute net charge at pH 7.0: N-term contributes +0.998 and the C-terminus contributes -1.000.
  3. 3Add the acidic side chains at pH 7.0: the two aspartates contribute about -1.999 and the glutamate about -0.998, giving a net charge of approximately -3.00.
  4. 4Because the molecule is net negative at neutral pH, its pI must lie well below 7; running the binary search drives the net charge to zero around pH 2.87.

Result:

pI is approximately 2.87, with a net charge of -3.00 at pH 7.0 and -3.00 at pH 7.4.

Basic peptide with lysines, arginines, and a histidine

Problem:

Estimate the pI and the net charge at pH 7.0 and pH 7.4 for a peptide with 3 lysine (K), 2 arginine (R), and 1 histidine (H) and no acidic side chains.

Solution Steps:

  1. 1List positive groups: N-terminus (pKa 9.69), 3 x Lys (pKa 10.53), 2 x Arg (pKa 12.48), 1 x His (pKa 6.00); the only negative group is the C-terminus (pKa 2.34).
  2. 2At pH 7.0 the three lysines are essentially fully protonated (about +3.00 total) and the two arginines are fully protonated (+2.00), while histidine is only about +0.09.
  3. 3Add the N-terminus (+0.998) and subtract the C-terminus (-1.000) to obtain a net charge near +5.09 at pH 7.0; at pH 7.4 it eases slightly to about +5.03.
  4. 4Since the peptide stays strongly positive far above neutral pH, the binary search locates the pI high in the alkaline range.

Result:

pI is approximately 12.51, with a net charge of +5.09 at pH 7.0 and +5.03 at pH 7.4.

Default hemoglobin alpha fragment (51 residues)

Problem:

Calculate the pI and net charges for the example sequence loaded by default, a 51-residue fragment of human hemoglobin alpha (MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH).

Solution Steps:

  1. 1Clean and count ionizable residues: 2 Asp (D), 3 Glu (E), 0 Cys (C), 2 Tyr (Y), 3 His (H), 4 Lys (K), 1 Arg (R), for 51 amino acids total.
  2. 2Sum basic groups (3 H, 4 K, 1 R plus N-terminus) against acidic groups (2 D, 3 E, 2 Y plus C-terminus) using the Henderson-Hasselbalch charge formula.
  3. 3Run the binary search from pH 0 to 14 to find where net charge crosses zero, which lands at pI 7.90.
  4. 4Evaluate the charge function at neutral and physiological pH to report the residual net charge.

Result:

pI is approximately 7.90, with a net charge of +0.27 at pH 7.0 and +0.11 at pH 7.4.

A free amino acid with no charged side chain

Problem:

Predict the pI of a residue such as glycine that has only the backbone termini and no ionizable side chain.

Solution Steps:

  1. 1Identify groups: only the N-terminus (+, pKa 9.69) and the C-terminus (-, pKa 2.34) are ionizable.
  2. 2The pI of such a zwitterion sits at the average of its two relevant pKa values, (9.69 + 2.34) / 2 = 6.015.
  3. 3Confirm with the calculator: the net charge at pH 7.0 is essentially zero, consistent with a pI just above 6.
  4. 4The binary search converges to a pI of about 6.01.

Result:

pI is approximately 6.01, with a net charge near 0.00 at pH 7.0.

Tips & Best Practices

  • Paste a clean single-letter amino acid sequence; spaces, numbers, and FASTA header lines are stripped automatically.
  • Choose a purification buffer pH at least one unit away from the pI to keep the protein soluble and well charged.
  • Load a protein below its pI to bind a cation exchanger, or above its pI to bind an anion exchanger.
  • Expect proteins rich in Asp and Glu to have low pI values, and proteins rich in Lys and Arg to have high pI values.
  • Remember that histidine is the only side chain that changes charge near physiological pH, so His-rich proteins are pH sensitive around pH 6 to 7.
  • Use the net charge at pH 7.4 to predict behavior in physiological conditions such as blood plasma.
  • Treat the calculated pI as a sequence-based estimate; verify with isoelectric focusing when an exact value is critical.
  • For crystallization screens, try buffer conditions near the pI where solubility is lowest.

Frequently Asked Questions

The pI is the pH at which the protein carries no net charge because its positive and negative charges are balanced. Below the pI the protein is net positive, and above the pI it is net negative. This single number lets you predict the direction the protein will migrate in an electric field and which ion-exchange resin it will bind at a chosen buffer pH.
It counts the ionizable side chains (D, E, C, Y, H, K, R) plus the free N- and C-termini, then applies the Henderson-Hasselbalch equation with fixed pKa values to compute net charge at any pH. It runs a binary search across pH 0 to 14, narrowing the interval to within 0.001 pH units, until it finds the pH where net charge equals zero. That pH is reported as the pI.
The calculator is sequence-based and uses standard pKa values for free residues, so it ignores the protein's three-dimensional fold, buried side chains, and local electrostatic interactions. Post-translational modifications such as phosphorylation, glycosylation, or disulfide bonds also shift the real pI. Treat the calculated pI as a reliable estimate and starting point rather than an exact measured constant.
At the pI the protein has no net charge, so there is no electrostatic repulsion to keep individual molecules apart. Without that repulsion the molecules can approach each other and aggregate, which lowers solubility and often causes precipitation. This is exactly why crystallization and precipitation protocols frequently target a pH near the pI.
Seven side chains are ionizable and affect the pI: aspartate (D), glutamate (E), cysteine (C), and tyrosine (Y) act as acids, while histidine (H), lysine (K), and arginine (R) act as bases. The free N-terminus adds one positive group and the free C-terminus adds one negative group. Nonionizable residues such as alanine, valine, or leucine do not change the pI even though they count toward sequence length.
pH 7.0 is neutral, while pH 7.4 is the physiological pH of human blood and most extracellular fluid. The calculator reports both so you can see how the net charge shifts slightly toward the negative as the pH rises. For proteins with a pI near neutrality, this small difference can change the sign of the net charge and matters for behavior in vivo.

Sources & References

Last updated: 2026-06-05

💡

Help us improve!

How would you rate the Isoelectric Point Calculator?

<>

Editorial Note

MyCalcBuddy Editorial Team

This page is maintained as an educational calculator reference.

Source

Formula Source: Standard Mathematical References

by Various

UpdatedLast reviewed: May 2026
CheckedFormula checks are based on standard references and internal QA review.

Privacy choices

MyCalcBuddy uses necessary storage for the site to work. Optional analytics, notifications, and future advertising features stay off unless you allow them.