Protein Molecular Weight Calculator

Calculate the molecular weight and properties of proteins from amino acid sequences

Input Sequence

Example: MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH

Additional Properties

Positive Residues (K, R, H)8
Negative Residues (D, E)5
Aliphatic Index61.37
GRAVY-0.204

Molecular Weight

5644.43 Da

5.644 kDa

Length

51 aa

Avg Residue MW

110.7

Extinction Coefficient

8,480 M⁻¹cm⁻¹

at 280 nm (assuming all Cys reduced)

Amino Acid Composition

A

7

14%

G

4

8%

L

4

8%

K

4

8%

F

4

8%

T

4

8%

E

3

6%

H

3

6%

P

3

6%

S

3

6%

V

3

6%

D

2

4%

M

2

4%

Y

2

4%

R

1

2%

N

1

2%

W

1

2%

About Protein Molecular Weight

Protein molecular weight is calculated from the sum of amino acid residue masses minus water lost during peptide bond formation.

The average amino acid residue mass is approximately 110 Da. Key features:

  • Extinction Coefficient: Based on Trp, Tyr, and Cys content
  • Aliphatic Index: Indicates thermostability
  • GRAVY: Grand Average of Hydropathy - positive values indicate hydrophobic proteins

What the Protein Molecular Weight Calculator Does

The protein molecular weight calculator turns a raw amino acid sequence into a usable molecular mass in daltons (Da) and kilodaltons (kDa), along with the supporting properties that biochemists and molecular biologists reach for every day. Paste a sequence written in the standard single-letter amino acid code and the tool counts each residue, sums the residue masses, corrects for the water released during peptide-bond formation, and reports the finished polypeptide mass. Because the calculation is deterministic, the same sequence always returns the same answer, which makes this protein MW calculator a quick sanity check when you order peptides, design constructs, or interpret a mass-spectrometry result.

Beyond raw mass, the calculator surfaces the metrics you actually need at the bench: the molar extinction coefficient at 280 nm for spectrophotometric concentration measurements, the count of positively and negatively charged residues, the aliphatic index as a proxy for thermostability, and GRAVY (Grand Average of Hydropathy) for a hydrophobicity read. It also lists the full amino acid composition so you can spot cysteine pairs, count tryptophans, or check that your codon-optimized gene encodes the protein you expect. Whether you are estimating the mass of an antibody fragment, a fusion tag, or a synthetic peptide, this amino acid sequence molecular weight calculator gives a reproducible starting number in a single step.

Protein Molecular Weight Formula

A protein is a chain of amino acids joined by peptide bonds. Each peptide bond forms by condensation, releasing one molecule of water. So the mass of the finished chain is the sum of the individual amino acid masses, minus the water lost for every bond, plus one water molecule to cap the free N-terminal amine and C-terminal carboxyl. For a chain of n residues there are n − 1 peptide bonds, giving the relationship below.

This calculator uses average isotopic masses for the twenty standard amino acids and a water mass of 18.015 Da. The average residue mass it reports is simply the total mass divided by the chain length, which for typical proteins lands near 110 Da per residue, a handy rule of thumb when you only know the residue count.

Polypeptide Molecular Weight

MW = Σ(residue_mw) − (n − 1) × 18.015 + 18.015

Where:

  • MW= Protein molecular weight in daltons (Da)
  • Σ(residue_mw)= Sum of the full molecular weights of every amino acid in the chain
  • n= Number of amino acid residues (chain length)
  • 18.015= Molecular weight of water (Da) lost per peptide bond and added back once for the terminal groups

Extinction Coefficient, Charge, Aliphatic Index and GRAVY

The calculator reports four derived properties that depend only on amino acid composition, so they are fast to compute and useful for planning experiments.

The molar extinction coefficient at 280 nm predicts how strongly your protein absorbs ultraviolet light, which you use with the Beer-Lambert law to convert an A280 reading into concentration. The tool weights each chromophore by its contribution, assuming all cysteines are reduced:

  • Tryptophan (W): 5500 M⁻¹cm⁻¹ each
  • Tyrosine (Y): 1490 M⁻¹cm⁻¹ each
  • Cysteine (C): 125 M⁻¹cm⁻¹ each

The charged residue counts tally positive residues (lysine K, arginine R, histidine H) and negative residues (aspartate D, glutamate E). Comparing these counts hints at the protein's net charge and helps you anticipate behavior on ion-exchange columns. The aliphatic index measures the relative volume occupied by aliphatic side chains (alanine, valine, isoleucine, leucine) and correlates with thermostability: higher values suggest a more heat-tolerant protein. Finally, GRAVY averages the Kyte-Doolittle hydropathy value across every residue; positive GRAVY points to a hydrophobic, possibly membrane-associated protein, while negative GRAVY indicates a soluble, hydrophilic one.

How to Use the Calculator

Using the protein molecular weight calculator takes only a few seconds:

  1. Enter your sequence in the text box using the one-letter amino acid code (for example, M for methionine, W for tryptophan, K for lysine).
  2. Let the tool clean the input. Spaces, numbers, line breaks, and any character that is not one of the twenty standard amino acid letters are automatically stripped before counting, so you can paste straight from a FASTA file.
  3. Read the molecular weight in both daltons and kilodaltons at the top of the results panel.
  4. Review the properties below it: chain length, average residue mass, extinction coefficient, charged residue counts, aliphatic index, and GRAVY.
  5. Inspect the composition grid to see how many of each amino acid appear and what fraction of the protein they represent.

Because only the twenty standard amino acids are recognized, non-standard residues, modifications, and stop symbols are ignored. If your sequence contains a selenocysteine (U), pyrrolysine (O), or an ambiguous letter such as X, remove or substitute it before relying on the mass for a critical calculation.

Interpreting and Validating the Result

The molecular weight this protein MW calculator returns is an average mass, the value you compare against a deconvoluted electrospray mass spectrum or an estimate from an SDS-PAGE ladder. Keep a few caveats in mind. SDS-PAGE often reports an apparent mass that can differ from the true mass by 10 percent or more, especially for highly charged, glycosylated, or membrane proteins, so a mismatch with the gel is not automatically an error. Post-translational modifications such as phosphorylation (+80 Da each), glycosylation (often hundreds to thousands of Da), disulfide bonds (−2 Da per bond), or removal of an initiator methionine all shift the experimental mass away from the sequence-only number computed here.

A good validation habit is the 110 Da check: multiply the residue count by roughly 110 Da and confirm the calculator's total lands in that ballpark. For the example 51-residue fragment, 51 × 110 ≈ 5610 Da, very close to the calculated 5644 Da. If your protein is far from that range, double-check that you pasted the full sequence and that unusual residues were not silently dropped. For concentration work, remember that the extinction coefficient assumes reduced cysteines; if your protein forms cystines (disulfides), the true 280 nm absorption is slightly higher.

Worked Examples

Tripeptide Gly-Ala-Val (GAV)

Problem:

Calculate the molecular weight of the tripeptide with sequence GAV.

Solution Steps:

  1. 1Sum the residue masses: Gly 75.07 + Ala 89.09 + Val 117.15 = 281.31 Da.
  2. 2There are n − 1 = 2 peptide bonds, so subtract 2 × 18.015 = 36.03 Da: 281.31 − 36.03 = 245.28 Da.
  3. 3Add one water (18.015 Da) for the terminal groups: 245.28 + 18.015 = 263.295 Da.
  4. 4Because GAV has no W, Y, or C, the extinction coefficient is 0 M⁻¹cm⁻¹.

Result:

Molecular weight ≈ 263.30 Da (0.263 kDa), length 3 aa, aliphatic index 130.00, GRAVY 1.867.

Pentapeptide Ala-Cys-Asp-Trp-Tyr (ACDWY)

Problem:

Find the molecular weight and 280 nm extinction coefficient of the sequence ACDWY.

Solution Steps:

  1. 1Sum the residue masses: A 89.09 + C 121.16 + D 133.10 + W 204.23 + Y 181.19 = 728.77 Da.
  2. 2Subtract water for n − 1 = 4 peptide bonds, then add one terminal water: 728.77 − (4 − 1) × 18.015 = 728.77 − 54.045 = 674.725 Da.
  3. 3Compute the extinction coefficient: 1×5500 (Trp) + 1×1490 (Tyr) + 1×125 (Cys) = 7115 M⁻¹cm⁻¹.
  4. 4Only alanine is aliphatic here, so the aliphatic index = 100 × (1) / 5 = 20.00.

Result:

Molecular weight ≈ 674.73 Da, ε280 = 7115 M⁻¹cm⁻¹, length 5 aa, GRAVY −0.280.

51-Residue Hemoglobin-Like Fragment

Problem:

Evaluate the default example sequence MVLSPADKTNVKAAWGKVGAHAGEYGAEALERMFLSFPTTKTYFPHFDLSH.

Solution Steps:

  1. 1The cleaned sequence contains 51 standard amino acid residues.
  2. 2Summing all 51 residue masses and applying − (51 − 1) × 18.015 + 18.015 yields the total mass.
  3. 3Average residue mass = total mass / length = 5644.43 / 51 ≈ 110.7 Da, matching the ~110 Da rule of thumb.
  4. 4Charged residues: 8 positive (K, R, H) and 5 negative (D, E); extinction coefficient = 8480 M⁻¹cm⁻¹.

Result:

Molecular weight ≈ 5644.43 Da (5.644 kDa), length 51 aa, aliphatic index 61.37, GRAVY −0.204.

Tips & Best Practices

  • Paste sequences in one-letter code; spaces, numbers, and line breaks are stripped automatically.
  • Use the molecular weight in both Da and kDa to label gels and size standards quickly.
  • Cross-check the total against the residue count times 110 Da as a fast sanity test.
  • Remember the extinction coefficient assumes reduced cysteines; oxidized cystines absorb slightly more at 280 nm.
  • Strip non-standard residues such as U, O, and X before relying on the mass for critical work.
  • Account for post-translational modifications separately when comparing to mass spectrometry results.
  • A positive GRAVY suggests a hydrophobic protein that may need detergents for solubility.
  • A higher aliphatic index hints at greater thermostability, useful when planning expression temperatures.

Frequently Asked Questions

It sums the average molecular weight of every amino acid in your sequence, then subtracts one water molecule (18.015 Da) for each of the n − 1 peptide bonds formed during synthesis and adds one water back for the free terminal groups. The result is the average mass of the intact polypeptide in daltons. This is the same average-mass approach used by standard tools such as ExPASy ProtParam.
The twenty standard amino acids range from glycine (about 57 Da as a residue) to tryptophan (about 186 Da as a residue), and a typical protein contains a mix weighted toward the more common medium-sized residues. Averaged across a real sequence, this works out to roughly 110 Da per residue, which is why multiplying your residue count by 110 gives a quick mass estimate.
No. The calculator works only from the amino acid sequence you enter and reflects the unmodified polypeptide. Modifications such as phosphorylation, glycosylation, acetylation, disulfide bond formation, or signal-peptide cleavage will shift the true experimental mass, so add or subtract their contributions separately when comparing to mass spectrometry data.
It predicts how strongly your protein absorbs ultraviolet light at 280 nm, which lets you convert an A280 reading into concentration using the Beer-Lambert law. The value is calculated from tryptophan (5500), tyrosine (1490), and cysteine (125) contributions and assumes all cysteines are reduced; proteins with disulfide bonds absorb slightly more strongly.
Before counting, the calculator converts your input to uppercase and removes anything that is not one of the twenty standard one-letter codes (A, R, N, D, C, E, Q, G, H, I, L, K, M, F, P, S, T, W, Y, V). Spaces, digits, line breaks, and non-standard letters such as U, O, B, Z, and X are ignored, so paste-from-FASTA works but exotic residues are silently dropped.
SDS-PAGE reports an apparent mass based on migration, which can deviate from the true mass by 10 percent or more for highly charged, glycosylated, or membrane proteins. The calculator gives the exact sequence-based average mass, so trust it for ordering peptides and interpreting mass spec, and treat gel estimates as approximate.

Sources & References

Last updated: 2026-06-05

💡

Help us improve!

How would you rate the Protein Molecular Weight Calculator?

<>

Editorial Note

MyCalcBuddy Editorial Team

This page is maintained as an educational calculator reference.

Source

Formula Source: Standard Mathematical References

by Various

UpdatedLast reviewed: May 2026
CheckedFormula checks are based on standard references and internal QA review.

Privacy choices

MyCalcBuddy uses necessary storage for the site to work. Optional analytics, notifications, and future advertising features stay off unless you allow them.